Recombinant Full Length Human Cd99 Antigen(Cd99) Protein, His-Tagged
Cat.No. : | RFL31233HF |
Product Overview : | Recombinant Full Length Human CD99 antigen(CD99) Protein (P14209) (23-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-185) |
Form : | Lyophilized powder |
AA Sequence : | DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD99 |
Synonyms | CD99; MIC2; MIC2X; MIC2Y; CD99 antigen; 12E7; E2 antigen; Protein MIC2; T-cell surface glycoprotein E2; CD antigen CD99 |
UniProt ID | P14209 |
◆ Recombinant Proteins | ||
CD99-126H | Recombinant Human CD99 protein, GST-tagged | +Inquiry |
CD99-590H | Active Recombinant Human CD99, Fc-tagged | +Inquiry |
CD99-26953TH | Recombinant Human CD99 Protein, GST-tagged | +Inquiry |
CD99-4271H | Recombinant Human CD99 Molecule | +Inquiry |
CD99-589H | Active Recombinant Human CD99, Fc-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD99-1360RCL | Recombinant Rat CD99 cell lysate | +Inquiry |
CD99-2203MCL | Recombinant Mouse CD99 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD99 Products
Required fields are marked with *
My Review for All CD99 Products
Required fields are marked with *
0
Inquiry Basket