Recombinant Full Length Human CD5 Protein, C-Flag-tagged
Cat.No. : | CD5-1438HFL |
Product Overview : | Recombinant Full Length Human CD5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQ WEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTP PTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFL KHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVG GSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQC HELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSRLSAYPALEGVLHRSSMQPDNSSDSDYDLH GAQRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Hematopoietic cell lineage |
Full Length : | Full L. |
Gene Name | CD5 CD5 molecule [ Homo sapiens (human) ] |
Official Symbol | CD5 |
Synonyms | T1; LEU1 |
Gene ID | 921 |
mRNA Refseq | NM_014207.4 |
Protein Refseq | NP_055022.2 |
MIM | 153340 |
UniProt ID | P06127 |
◆ Recombinant Proteins | ||
CD5-173H | Recombinant Human CD5 Protein, C-His-tagged | +Inquiry |
CD5-2999HF | Recombinant Full Length Human CD5 Protein, GST-tagged | +Inquiry |
CD5-830H | Recombinant Human CD5 Protein, DDK/His-tagged | +Inquiry |
Cd5-8796R | Active Recombinant Rat Cd5 protein, His-tagged | +Inquiry |
CD5-491H | Recombinant Human CD5 Protein (Arg25-Pro372), C-6×His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD5-1293RCL | Recombinant Rat CD5 cell lysate | +Inquiry |
CD5-2498MCL | Recombinant Mouse CD5 cell lysate | +Inquiry |
CD5-2572HCL | Recombinant Human CD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD5 Products
Required fields are marked with *
My Review for All CD5 Products
Required fields are marked with *
0
Inquiry Basket