Recombinant Full Length Human CD276 molecule VLPs Protein, GFP-tagged

• Cat.No.: B7H3-001HV
• Product Overview: Recombinant Full Length Human CD276 VLPs Protein with GFP-tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: EGFP
• Protein Length: Full length
• Description: The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3' UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Tag: C-EGFP
• AA Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
• Endotoxin: < 1 EU/μg by LAL.
• Notes: Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.
  The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
• Storage: Store it under sterile conditions at -20 to -80 centigrade twelve months from the date of receipt.
• Storage Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6 % Trehalose, pH 7.4.
  The volume before lyophilization is 89μl/vial.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 centigrade.
  Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vertexing.

Gene Information

• Gene Name: CD276 CD276 molecule [Homo sapiens (human)]
• Official Symbol: CD276
• Synonyms: CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3
• Gene ID: 80381
• mRNA Refseq: NM_001024736
• Protein Refseq: NP_001019907
• MIM: 605715
• UniProt ID: Q5ZPR3

Reviews

01/25/2025

B7H3-001HV

We did see some binding .. which was a lot better than other VLPs we purchased from other companies.