Recombinant Mouse CD276 Protein

Cat.No. : CD276-601M
Product Overview : Recombinant Mouse CD276 protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Enables identical protein binding activity and signaling receptor binding activity. Acts upstream of or within several processes, including positive regulation of osteoblast differentiation; regulation of T cell proliferation; and regulation of cytokine production. Located in external side of plasma membrane. Is expressed in several structures, including embryo endoderm; genitourinary system; hemolymphoid system; liver; and musculoskeletal system. Orthologous to human CD276 (CD276 molecule).
Source : HEK293
Species : Mouse
Form : Lyophilized
Molecular Mass : 25.4 kDa
Protein length : 316
AA Sequence : MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTALRPLKPSENKEDDGQEIA
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Cd276 CD276 antigen [ Mus musculus (house mouse) ]
Official Symbol CD276
Synonyms CD276; CD276 antigen; B7-H3; B7 homolog 3; costimulatory molecule; B7h3; B7RP-2; AU016588; 6030411F23Rik;
Gene ID 102657
mRNA Refseq NM_133983
Protein Refseq NP_598744
UniProt ID Q8VE98

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD276 Products

Required fields are marked with *

My Review for All CD276 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon