Recombinant Full Length Human CD247 Protein

• Cat.No.: CD247-56HF
• Product Overview: Recombinant full length protein of Human CD3 zeta with proprietary tag; Predicted MWt 43.76 kDa inclusive of tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 164 amino acids
• Description: The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Form: Liquid
• Molecular Mass: 43.760kDa inclusive of tags
• AA Sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CD247 CD247 molecule [ Homo sapiens ]
• Official Symbol: CD247
• Synonyms: CD247; CD247 molecule; CD3Z, CD3z antigen, zeta polypeptide (TiT3 complex) , CD247 antigen; T-cell surface glycoprotein CD3 zeta chain; CD3H; CD3Q
• Gene ID: 919
• mRNA Refseq: NM_000734
• Protein Refseq: NP_000725
• MIM: 186780
• UniProt ID: P20963