Recombinant Full Length Human CD19 Protein, C-Flag-tagged
Cat.No. : | CD19-32HFL |
Product Overview : | Recombinant Full Length Human CD19 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the immunoglobulin gene superfamily. Expression of this cell surface protein is restricted to B cell lymphocytes. This protein is a reliable marker for pre-B cells but its expression diminishes during terminal B cell differentiation in antibody secreting plasma cells. The protein has two N-terminal extracellular Ig-like domains separated by a non-Ig-like domain, a hydrophobic transmembrane domain, and a large C-terminal cytoplasmic domain. This protein forms a complex with several membrane proteins including complement receptor type 2 (CD21) and tetraspanin (CD81) and this complex reduces the threshold for antigen-initiated B cell activation. Activation of this B-cell antigen receptor complex activates the phosphatidylinositol 3-kinase signalling pathway and the subsequent release of intracellular stores of calcium ions. This protein is a target of chimeric antigen receptor (CAR) T-cells used in the treatment of lymphoblastic leukemia. Mutations in this gene are associated with the disease common variable immunodeficiency 3 (CVID3) which results in a failure of B-cell differentiation and impaired secretion of immunoglobulins. CVID3 is characterized by hypogammaglobulinemia, an inability to mount an antibody response to antigen, and recurrent bacterial infections. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.9 kDa |
AA Sequence : | MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPG LGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRS SEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRG PLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVL WHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGN VLSLPTPTSGLGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLSPHGSAWDPSR EATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | B cell receptor signaling pathway, Hematopoietic cell lineage, Primary immunodeficiency |
Full Length : | Full L. |
Gene Name | CD19 CD19 molecule [ Homo sapiens (human) ] |
Official Symbol | CD19 |
Synonyms | B4; CVID3 |
Gene ID | 930 |
mRNA Refseq | NM_001770.6 |
Protein Refseq | NP_001761.3 |
MIM | 107265 |
UniProt ID | P15391 |
◆ Recombinant Proteins | ||
Cd19-3308MF | Active Recombinant Mouse Cd19 Protein, His-tagged, FITC conjugated | +Inquiry |
CD19-127H | Recombinant Human CD19 Protein, Fc-tagged, Biotinylated | +Inquiry |
CD19-0726H | Recombinant Human CD19 Protein (Pro20-Lys291), His tagged | +Inquiry |
CD19-408HA | Recombinant Human CD19 protein, Fc-tagged, APC labeled | +Inquiry |
CD19-3063H | Recombinant Human CD19 protein, His-tagged, Alexa Fluor 488-Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD19-2005HCL | Recombinant Human CD19 cell lysate | +Inquiry |
CD19-2164MCL | Recombinant Mouse CD19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD19 Products
Required fields are marked with *
My Review for All CD19 Products
Required fields are marked with *
0
Inquiry Basket