Recombinant Full Length Human CCK Protein, GST-tagged
Cat.No. : | CCK-2917HF |
Product Overview : | Human CCK full-length ORF (AAH08283, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 115 amino acids |
Description : | This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake. A sulfated form of cholecystokinin-8 may modulate neuronal activity in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 38.39 kDa |
AA Sequence : | MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCK cholecystokinin [ Homo sapiens ] |
Official Symbol | CCK |
Synonyms | CCK; cholecystokinin; MGC117187; |
Gene ID | 885 |
mRNA Refseq | NM_000729 |
Protein Refseq | NP_000720 |
MIM | 118440 |
UniProt ID | P06307 |
◆ Recombinant Proteins | ||
CCK-7725D | Recombinant Dog CCK protein, His & GST-tagged | +Inquiry |
Cck-7727M | Recombinant Mouse Cck protein, His & GST-tagged | +Inquiry |
CCK-7726H | Recombinant Human CCK protein, His & GST-tagged | +Inquiry |
CCK-2917HF | Recombinant Full Length Human CCK Protein, GST-tagged | +Inquiry |
CCK-1388M | Recombinant Mouse CCK Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCK-7737HCL | Recombinant Human CCK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCK Products
Required fields are marked with *
My Review for All CCK Products
Required fields are marked with *
0
Inquiry Basket