Recombinant Full Length Human CCDC42 Protein, GST-tagged

Cat.No. : CCDC42-2862HF
Product Overview : Human CCDC42 full-length ORF (AAH29224.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 242 amino acids
Description : CCDC42 (Coiled-Coil Domain Containing 42) is a Protein Coding gene. An important paralog of this gene is CFAP73.
Molecular Mass : 55.4 kDa
AA Sequence : MSLGIMEEEDLAEYFRLQYGERLLQMLQKLPNVEGASESPSIWLLEKKKETEIMHQTMVQKKKMFQRRMETLNLRWEELGVKEAQLKAHIQKSEQFIQENDQKRIRAMKKANKERELKCQHMQELTKRKQEMVALRLEHQRLSAKLKDYYIFNKYLEKVVENSEESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKHLKEVTEVALEDTHKQLDMIQQFIQDRSDIWAEVKKKEQQRVRI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC42 coiled-coil domain containing 42 [ Homo sapiens ]
Official Symbol CCDC42
Synonyms CCDC42; coiled-coil domain containing 42; coiled-coil domain-containing protein 42A; CCDC42A; FLJ32734;
Gene ID 146849
mRNA Refseq NM_001158261
Protein Refseq NP_001151733
UniProt ID Q96M95

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC42 Products

Required fields are marked with *

My Review for All CCDC42 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon