Recombinant Full Length Human CCDC28B Protein, GST-tagged

• Cat.No.: CCDC28B-2856HF
• Product Overview: Human CCDC28B full-length ORF (NP_077272.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 200 amino acids
• Description: The product of this gene localizes to centrosomes and basal bodies. The protein colocalizes with several proteins associated with Bardet-Biedl syndrome (BBS) and participates in the regulation of cilia development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Molecular Mass: 48.4 kDa
• AA Sequence: MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGSGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC28B coiled-coil domain containing 28B [ Homo sapiens ]
• Official Symbol: CCDC28B
• Synonyms: CCDC28B; coiled-coil domain containing 28B; coiled-coil domain-containing protein 28B; MGC1203; RP4 622L5.5; RP4-622L5.5; MGC16441
• Gene ID: 79140
• mRNA Refseq: NM_024296
• Protein Refseq: NP_077272
• MIM: 610162
• UniProt ID: Q9BUN5