Recombinant Full Length Human CC2D2B Protein, GST-tagged

• Cat.No.: CC2D2B-2790HF
• Product Overview: Human CC2D2B full-length ORF (ENSP00000343747, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 262 amino acids
• Description: CC2D2B (Coiled-Coil And C2 Domain Containing 2B) is a Protein Coding gene. Diseases associated with CC2D2B include Meckel Syndrome 1 and Joubert Syndrome 1. An important paralog of this gene is CC2D2A.
• Molecular Mass: 56.5 kDa
• AA Sequence: MFPNRRIVTTVFNDEGIQFLVTRYIKALNPPQQLLDIFLHNSNATFDLIARFVSLIPFVPNTPDENDGSDIWMTSEHCISLAIGNKEEHAILLCNFFLYFGKKALVLLGTSVLEGHVAYVVTQETNEYLLWNPSTGQCYKQFDPFCPLKSVDCLFDDRNVWFNIQQNNTPMAVFFDYSKESFWKQLLPKNVQGTKIQSIQVTGFPIQMPYIDVQSIIDAVYQTGIHSAEFPQTEFALAVYIHPYPNNILSVWVYLASLVQHQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CC2D2B coiled-coil and C2 domain containing 2B [ Homo sapiens ]
• Official Symbol: CC2D2B
• Synonyms: C10orf130; bA248J23.4
• Gene ID: 387707
• mRNA Refseq: NM_001159747
• Protein Refseq: NP_001153219
• UniProt ID: Q6DHV5