Recombinant Full Length Human CBX6 Protein, GST-tagged

• Cat.No.: CBX6-2782HF
• Product Overview: Human CBX6 full-length ORF (AAH12111.1, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 412 amino acids
• Description: CBX6 (Chromobox 6) is a Protein Coding gene. Among its related pathways are Cellular Senescence. GO annotations related to this gene include single-stranded RNA binding. An important paralog of this gene is CBX8.
• Molecular Mass: 70.3 kDa
• AA Sequence: MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTLPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CBX6 chromobox homolog 6 [ Homo sapiens ]
• Official Symbol: CBX6
• Synonyms: CBX6; chromobox homolog 6; chromobox protein homolog 6
• Gene ID: 23466
• mRNA Refseq: NM_014292
• Protein Refseq: NP_055107
• MIM: 617438
• UniProt ID: O95503