Recombinant Full Length Human CBX5 Protein, GST-tagged

Cat.No. : CBX5-2781HF
Product Overview : Human CBX5 full-length ORF (AAH06821, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 191 amino acids
Description : This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Molecular Mass : 46.75 kDa
AA Sequence : MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CBX5 chromobox homolog 5 [ Homo sapiens ]
Official Symbol CBX5
Synonyms CBX5; chromobox homolog 5; chromobox homolog 5 (Drosophila HP1 alpha), chromobox homolog 5 (HP1 alpha homolog, Drosophila); chromobox protein homolog 5; HP1; HP1 alpha homolog (Drosophila); HP1 ALPHA; HP1Hs alpha; HP1-ALPHA; antigen p25; HP1 alpha homolog; heterochromatin protein 1-alpha; heterochromatin protein 1 homolog alpha; chromobox homolog 5 (HP1 alpha homolog, Drosophila); HP1A;
Gene ID 23468
mRNA Refseq NM_001127321
Protein Refseq NP_001120793
MIM 604478
UniProt ID P45973

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CBX5 Products

Required fields are marked with *

My Review for All CBX5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon