Recombinant Full Length Human CASP6 Protein, GST-tagged

Cat.No. : CASP6-2929HF
Product Overview : Human CASP6 full-length ORF (AAH00305.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 293 amino acids
Description : This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Oct 2015]
Molecular Mass : 58.63 kDa
AA Sequence : MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEKLLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CASP6 caspase 6, apoptosis-related cysteine peptidase [ Homo sapiens ]
Official Symbol CASP6
Synonyms CASP6; caspase 6, apoptosis-related cysteine peptidase; caspase 6, apoptosis related cysteine protease; caspase-6; MCH2; apoptotic protease MCH-2; caspase 6, apoptosis-related cysteine protease;
Gene ID 839
mRNA Refseq NM_001226
Protein Refseq NP_001217
MIM 601532
UniProt ID P55212

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CASP6 Products

Required fields are marked with *

My Review for All CASP6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon