Recombinant Full Length Human CASP2 Protein, GST-tagged

• Cat.No.: CASP2-2926HF
• Product Overview: Human CASP2 full-length ORF (AAH02427.2, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimer's disease, Huntington's disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 77.1 kDa
• Protein length: 452 amino acids
• AA Sequence: MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CASP2 caspase 2, apoptosis-related cysteine peptidase [ Homo sapiens ]
• Official Symbol: CASP2
• Synonyms: CASP2; caspase 2, apoptosis-related cysteine peptidase; NEDD2, neural precursor cell expressed, developmentally down regulated 2; caspase-2; ICH1; PPP1R57; protein phosphatase 1; regulatory subunit 57; protease ICH-1; protein phosphatase 1, regulatory subunit 57; neural precursor cell expressed developmentally down-regulated protein 2; NEDD2; CASP-2; NEDD-2
• Gene ID: 835
• mRNA Refseq: NM_001224
• Protein Refseq: NP_001215
• MIM: 600639
• UniProt ID: P42575