Recombinant Full Length Human CARM1 Protein, C-Flag-tagged
Cat.No. : | CARM1-1535HFL |
Product Overview : | Recombinant Full Length Human CARM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.7 kDa |
AA Sequence : | MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDSAGIA LYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSER TEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVXLWLWDPVVFCRPSWSTEN LRGXRPAPWPSTXEVLVKSNNLTDRIVVIPGKVXGXCXXPXXQVDIIXLGAHGLHALQRXACWRATSTPX KYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIR ILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWY QVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPG SHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMS TGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | CARM1 coactivator associated arginine methyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | CARM1 |
Synonyms | PRMT4 |
Gene ID | 10498 |
mRNA Refseq | NM_199141.2 |
Protein Refseq | NP_954592.1 |
MIM | 603934 |
UniProt ID | Q86X55 |
◆ Recombinant Proteins | ||
CARM1-4776H | Recombinant Human CARM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Carm1-1966M | Recombinant Mouse Carm1 Protein, Myc/DDK-tagged | +Inquiry |
CARM1-503H | Recombinant Human CARM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CARM1-1232M | Recombinant Mouse CARM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CARM1-0402H | Recombinant Human CARM1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARM1-7846HCL | Recombinant Human CARM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CARM1 Products
Required fields are marked with *
My Review for All CARM1 Products
Required fields are marked with *
0
Inquiry Basket