Recombinant Full Length Human CALR3 Protein, GST-tagged
Cat.No. : | CALR3-3079HF |
Product Overview : | Human CALR3 full-length ORF (AAH14595, 21 a.a. - 384 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 21-384 amino acids |
Description : | The protein encoded by this gene belongs to the calreticulin family, members of which are calcium-binding chaperones localized mainly in the endoplasmic reticulum. This protein is also localized to the endoplasmic reticulum lumen, however, its capacity for calcium-binding may be absent or much lower than other family members. This gene is specifically expressed in the testis, and may be required for sperm fertility. Mutation in this gene has been associated with familial hypertrophic cardiomyopathy. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 65.78 kDa |
AA Sequence : | VYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CALR3 calreticulin 3 [ Homo sapiens ] |
Official Symbol | CALR3 |
Synonyms | CALR3; calreticulin 3; calreticulin-3; calsperin; cancer/testis antigen 93; CRT2; CT93; FLJ25355; MGC26577; calreticulin-2; CMH19; |
Gene ID | 125972 |
mRNA Refseq | NM_145046 |
Protein Refseq | NP_659483 |
MIM | 611414 |
UniProt ID | Q96L12 |
◆ Recombinant Proteins | ||
CALR3-1907H | Recombinant Human CALR3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CALR3-5077H | Recombinant Human CALR3, His-tagged | +Inquiry |
Calr3-1941M | Recombinant Mouse Calr3 Protein, Myc/DDK-tagged | +Inquiry |
CALR3-271H | Recombinant Human CALR3 protein | +Inquiry |
CALR3-0314H | Recombinant Human CALR3 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALR3-7884HCL | Recombinant Human CALR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALR3 Products
Required fields are marked with *
My Review for All CALR3 Products
Required fields are marked with *
0
Inquiry Basket