Recombinant Full Length Human CALR Protein, C-Flag-tagged
Cat.No. : | CALR-90HFL |
Product Overview : | Recombinant Full Length Human CALR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Calreticulin is a highly conserved chaperone protein which resides primarily in the endoplasmic reticulum, and is involved in a variety of cellular processes, among them, cell adhesion. Additionally, it functions in protein folding quality control and calcium homeostasis. Calreticulin is also found in the nucleus, suggesting that it may have a role in transcription regulation. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin. Recurrent mutations in calreticulin have been linked to various neoplasms, including the myeloproliferative type. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.4 kDa |
AA Sequence : | MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQ DARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPG TKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKD PDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQI DNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT KAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein, Transcription Factors |
Protein Pathways : | Antigen processing and presentation |
Full Length : | Full L. |
Gene Name | CALR calreticulin [ Homo sapiens (human) ] |
Official Symbol | CALR |
Synonyms | RO; CRT; SSA; cC1qR; HEL-S-99n |
Gene ID | 811 |
mRNA Refseq | NM_004343.4 |
Protein Refseq | NP_004334.1 |
MIM | 109091 |
UniProt ID | P27797 |
◆ Recombinant Proteins | ||
Calr-356M | Recombinant Mouse Calr Protein, His-tagged | +Inquiry |
CALR-0313H | Recombinant Human CALR Protein, GST-Tagged | +Inquiry |
CALR-8675Z | Recombinant Zebrafish CALR | +Inquiry |
CALR-5193H | Recombinant Human CALR Protein (Met1-Ala413), C-His tagged | +Inquiry |
CALR-3232H | Recombinant Human CALR protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALR-1222HCL | Recombinant Human CALR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALR Products
Required fields are marked with *
My Review for All CALR Products
Required fields are marked with *
0
Inquiry Basket