Recombinant Full Length Human CALML6 Protein, GST-tagged

• Cat.No.: CALML6-3067HF
• Product Overview: Human CALML6 full-length ORF (AAI60060.1, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CALML6 (Calmodulin Like 6) is a Protein Coding gene. Among its related pathways are Vascular smooth muscle contraction and Tuberculosis. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CALM2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 46.31 kDa
• Protein length: 181 amino acids
• AA Sequence: MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CALML6 calmodulin like 6 [ Homo sapiens (human) ]
• Official Symbol: CALML6
• Synonyms: CALML6; calmodulin like 6; calmodulin-like protein 6; EF-hand protein; calglandulin-like protein; CAGLP; Calmodulin Like 6; Calglandulin-Like Protein; CAGLP; Calmodulin-Like Protein 6; Calmodulin-Like 6; EF-Hand Protein; CALGP
• Gene ID: 163688
• mRNA Refseq: NM_001330313
• Protein Refseq: NP_001317242
• MIM: 610171
• UniProt ID: Q8TD86