Recombinant Full Length Human CALML6 Protein, GST-tagged

Cat.No. : CALML6-3067HF
Product Overview : Human CALML6 full-length ORF (AAI60060.1, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CALML6 (Calmodulin Like 6) is a Protein Coding gene. Among its related pathways are Vascular smooth muscle contraction and Tuberculosis. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CALM2.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 46.31 kDa
Protein length : 181 amino acids
AA Sequence : MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CALML6 calmodulin like 6 [ Homo sapiens (human) ]
Official Symbol CALML6
Synonyms CALML6; calmodulin like 6; calmodulin-like protein 6; EF-hand protein; calglandulin-like protein; CAGLP; Calmodulin Like 6; Calglandulin-Like Protein; CAGLP; Calmodulin-Like Protein 6; Calmodulin-Like 6; EF-Hand Protein; CALGP
Gene ID 163688
mRNA Refseq NM_001330313
Protein Refseq NP_001317242
MIM 610171
UniProt ID Q8TD86

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CALML6 Products

Required fields are marked with *

My Review for All CALML6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon