Recombinant Full Length Human CALCOCO2 Protein, C-Flag-tagged
Cat.No. : | CALCOCO2-770HFL |
Product Overview : | Recombinant Full Length Human CALCOCO2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a coiled-coil domain-containing protein. The encoded protein functions as a receptor for ubiquitin-coated bacteria and plays an important role in innate immunity by mediating macroautophagy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.1 kDa |
AA Sequence : | MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYY TFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQG EVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELL QLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQK KLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF NCPICDKIFPATEKQIFEDHVFCHSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CALCOCO2 calcium binding and coiled-coil domain 2 [ Homo sapiens (human) ] |
Official Symbol | CALCOCO2 |
Synonyms | NDP52 |
Gene ID | 10241 |
mRNA Refseq | NM_005831.5 |
Protein Refseq | NP_005822.1 |
MIM | 604587 |
UniProt ID | Q13137 |
◆ Recombinant Proteins | ||
PTGS2-010S | Active Recombinant Sheep PTGS2 Protein | +Inquiry |
ADRB2-1131HFL | Recombinant Human ADRB2 protein, His&Flag-tagged | +Inquiry |
rpsB-4454E | Recombinant Escherichia coli rpsB protein, His-SUMO & Myc-tagged | +Inquiry |
IRF3-4603M | Recombinant Mouse IRF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCDIN3D-953R | Recombinant Rat BCDIN3D Protein | +Inquiry |
◆ Native Proteins | ||
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
PLAU-22H | Native Human PLAU protein | +Inquiry |
Lectin-1823P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Biotinylated | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST10-7508HCL | Recombinant Human CHST10 293 Cell Lysate | +Inquiry |
KLHDC4-4920HCL | Recombinant Human KLHDC4 293 Cell Lysate | +Inquiry |
IL1R2-834CCL | Recombinant Canine IL1R2 cell lysate | +Inquiry |
SERPINB1-578HCL | Recombinant Human SERPINB1 cell lysate | +Inquiry |
RNPEPL1-2260HCL | Recombinant Human RNPEPL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CALCOCO2 Products
Required fields are marked with *
My Review for All CALCOCO2 Products
Required fields are marked with *
0
Inquiry Basket