Recombinant Full Length Human CABP5 Protein, GST-tagged

• Cat.No.: CABP5-2767HF
• Product Overview: Human CABP5 full-length ORF (ADR82830.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 173 amino acids
• Description: The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene is retina-specific. The mouse homolog of this protein has been shown to express in the inner nuclear layer of the retina, suggested its role in neuronal functioning. The specific function of this gene is unknown. [provided by RefSeq, Oct 2009]
• Molecular Mass: 19.1 kDa
• AA Sequence: MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CABP5 calcium binding protein 5 [ Homo sapiens ]
• Official Symbol: CABP5
• Synonyms: CABP5; calcium binding protein 5; CABP3, calcium binding protein 3; calcium-binding protein 5; CaBP3; calcium-binding protein 3; CABP3
• Gene ID: 56344
• mRNA Refseq: NM_019855
• Protein Refseq: NP_062829
• MIM: 607315
• UniProt ID: Q9NP86