Recombinant Full Length Human CA13 Protein, GST-tagged

Cat.No. : CA13-2735HF
Product Overview : Human CA13 full-length ORF (NP_940986.1, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.[supplied by OMIM, Mar 2008]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 55.8 kDa
Protein length : 262 amino acids
AA Sequence : MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CA13 carbonic anhydrase XIII [ Homo sapiens ]
Official Symbol CA13
Synonyms CA13; carbonic anhydrase XIII; carbonic anhydrase 13; CAXIII; FLJ37995; MGC59868; CA-XIII; carbonate dehydratase XIII; FLJ36434;
Gene ID 377677
mRNA Refseq NM_198584
Protein Refseq NP_940986
MIM 611436
UniProt ID Q8N1Q1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CA13 Products

Required fields are marked with *

My Review for All CA13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon