Recombinant Human CA13 Protein, GST-Tagged

• Cat.No.: CA13-0235H
• Product Overview: Human CA13 full-length ORF (NP_940986.1, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.[supplied by OMIM, Mar 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 55.8 kDa
• AA Sequence: MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CA13 carbonic anhydrase XIII [ Homo sapiens ]
• Official Symbol: CA13
• Synonyms: CA13; carbonic anhydrase XIII; carbonic anhydrase 13; CAXIII; FLJ37995; MGC59868; CA-XIII; carbonate dehydratase XIII; FLJ36434
• Gene ID: 377677
• mRNA Refseq: NM_198584
• Protein Refseq: NP_940986
• MIM: 611436
• UniProt ID: Q8N1Q1