Recombinant Full Length Human C9orf57 Protein
Cat.No. : | C9orf57-2717HF |
Product Overview : | Human C9orf57 full-length ORF (ADR83461.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | C9orf57 (Chromosome 9 Open Reading Frame 57) is a Protein Coding gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 14 kDa |
Protein length : | 298 amino acids |
AA Sequence : | MGVGFTELEYLAPWLRPPFSDLGTCQTKPGQYWKEEVHIQDVGGLICRACNLSLPFHGCLLDLGTCQAEPGQYCKEEVHIQGGIQWYSVKGCTKNTSECFKSTLVKRILQLHELVTTHCCNHSLCNF |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | C9orf57 chromosome 9 open reading frame 57 [ Homo sapiens ] |
Official Symbol | C9orf57 |
Synonyms | RP11-346E17.3 |
Gene ID | 138240 |
mRNA Refseq | NM_001128618 |
Protein Refseq | NP_001122090 |
UniProt ID | Q5W0N0 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All C9orf57 Products
Required fields are marked with *
My Review for All C9orf57 Products
Required fields are marked with *
0
Inquiry Basket