Recombinant Full Length Human C9orf57 Protein

• Cat.No.: C9orf57-2717HF
• Product Overview: Human C9orf57 full-length ORF (ADR83461.1) recombinant protein without tag.

Specification

• Description: C9orf57 (Chromosome 9 Open Reading Frame 57) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 14 kDa
• Protein length: 298 amino acids
• AA Sequence: MGVGFTELEYLAPWLRPPFSDLGTCQTKPGQYWKEEVHIQDVGGLICRACNLSLPFHGCLLDLGTCQAEPGQYCKEEVHIQGGIQWYSVKGCTKNTSECFKSTLVKRILQLHELVTTHCCNHSLCNF
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: C9orf57 chromosome 9 open reading frame 57 [ Homo sapiens ]
• Official Symbol: C9orf57
• Synonyms: RP11-346E17.3
• Gene ID: 138240
• mRNA Refseq: NM_001128618
• Protein Refseq: NP_001122090
• UniProt ID: Q5W0N0