Recombinant Full Length Human C9orf170 Protein, GST-tagged

• Cat.No.: C9orf170-3917HF
• Product Overview: Human C9orf170 full-length ORF ( ADR82813.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C9orf170 (Chromosome 9 Open Reading Frame 170) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 13.4 kDa
• Protein length: 121 amino acids
• AA Sequence: MWSRRGLGVSRAPLHLLLGVWGPSGRTGGQRKGASLARPGRGGLASCSVGANGKRDVLFLRKTLTNTVEDIQIDNFRRKSDLGVGSPDWKNLLIDVTREDHENSQNNSKRRCKVNCETDQR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C9orf170 chromosome 9 open reading frame 170 [ Homo sapiens (human) ]
• Official Symbol: C9orf170
• Synonyms: FLJ45537; C9orf170; chromosome 9 open reading frame 170; uncharacterized protein C9orf170
• Gene ID: 401535
• mRNA Refseq: NM_001001709
• Protein Refseq: NP_001001709
• UniProt ID: A2RU37