Recombinant Full Length Human C9orf139 Protein, GST-tagged

• Cat.No.: C9orf139-2686HF
• Product Overview: Human C9orf139 full-length ORF (ADR83488.1, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 190 amino acids
• Description: C9orf139 (Chromosome 9 Open Reading Frame 139) is a Protein Coding gene.
• Molecular Mass: 20.9 kDa
• AA Sequence: MALRGHPEPQPTNTPLSATVGGPISLFTQPRCHSAARDLVWSQAWPDPDVLEISMQTPGGSSCRKEAVLPRLRVTRPLVPEPAILPVCAARLAGSLATDLSRSHSLLPPWVDLKEPPPPSAPSLLLEDPGQGGCHGAQSCVGTCELANGARGFCPEMGQNESLSEEREGHESKRKSGGRGSPSSHPTQAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C9orf139 chromosome 9 open reading frame 139 [ Homo sapiens ]
• Official Symbol: C9orf139
• Synonyms: C9orf139; chromosome 9 open reading frame 139; Chromosome 9 Open Reading Frame 139
• Gene ID: 401563
• mRNA Refseq: NM_207511
• Protein Refseq: NP_997394
• UniProt ID: Q6ZV77