Recombinant Full Length Human C9orf116 Protein, GST-tagged
Cat.No. : | C9orf116-2680HF |
Product Overview : | Human C9orf116 full-length ORF (AAH21261.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 92 amino acids |
Description : | C9orf116 (Chromosome 9 Open Reading Frame 116) is a Protein Coding gene. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPRVECSGTILSMFTWRKAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C9orf116 chromosome 9 open reading frame 116 [ Homo sapiens ] |
Official Symbol | C9orf116 |
Synonyms | PIERCE1; RbEST47; RP11-426A6.4 |
Gene ID | 138162 |
mRNA Refseq | NM_144654 |
Protein Refseq | NP_653255 |
MIM | 614502 |
UniProt ID | Q5BN46 |
◆ Recombinant Proteins | ||
C9orf116-2680HF | Recombinant Full Length Human C9orf116 Protein, GST-tagged | +Inquiry |
C9orf116-0181H | Recombinant Human C9orf116 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf116-7942HCL | Recombinant Human C9orf116 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C9orf116 Products
Required fields are marked with *
My Review for All C9orf116 Products
Required fields are marked with *
0
Inquiry Basket