Recombinant Full Length Human C8orf44 Protein, GST-tagged

• Cat.No.: C8orf44-2644HF
• Product Overview: Human C8orf44 full-length ORF (NP_062553.1, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C8orf44 (Chromosome 8 Open Reading Frame 44) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 44.8 kDa
• Protein length: 159 amino acids
• AA Sequence: MRKNESYLNQPAPPIPIPTLSLMGGCREHFENHWKGRARWLMPVIPALWEAKAGRSPEVRSSKPAWPTWRNPIFTKNTKISQVLELFLNYQSLICALEKQKRQKGSLAIFCWSFQGGCVSKRPDVPSLKSQKPKRKRITGRKRLSKGFWSLLFSNLGRF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C8orf44 chromosome 8 open reading frame 44 [ Homo sapiens ]
• Official Symbol: C8orf44
• Synonyms: C8orf44; chromosome 8 open reading frame 44; putative uncharacterized protein C8orf44
• Gene ID: 56260
• mRNA Refseq: NM_019607
• Protein Refseq: NP_062553
• UniProt ID: Q96CB5