Recombinant Full Length Human C8orf33 Protein, GST-tagged

Cat.No. : C8orf33-4902HF
Product Overview : Human FLJ20989 full-length ORF ( AAH10001, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 229 amino acids
Description : C8orf33 (Chromosome 8 Open Reading Frame 33) is a Protein Coding gene.
Molecular Mass : 50.93 kDa
AA Sequence : MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C8orf33 chromosome 8 open reading frame 33 [ Homo sapiens ]
Official Symbol C8orf33
Synonyms C8ORF33; chromosome 8 open reading frame 33; UPF0488 protein C8orf33; FLJ20989;
Gene ID 65265
mRNA Refseq NM_023080
Protein Refseq NP_075568
UniProt ID Q9H7E9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C8orf33 Products

Required fields are marked with *

My Review for All C8orf33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon