Recombinant Full Length Human C7orf61 Protein, GST-tagged
Cat.No. : | C7orf61-2632HF |
Product Overview : | Human C7orf61 full-length ORF (NP_001004323.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 206 amino acids |
Description : | C7orf61 (Chromosome 7 Open Reading Frame 61) is a Protein Coding gene. |
Molecular Mass : | 50.3 kDa |
AA Sequence : | MVVVMKFFRWVRRAWQRIISWVFFWRQKIKPTISGHPDSKKHSLKKMEKTLQVVETLRLVELPKEAKPKLGESPELADPCVLAKTTEETEVELGQQGQSLLQLPRTAVKSVSTLMVSALQSGWQMCSWKSSVSSASVSSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C7orf61 chromosome 7 open reading frame 61 [ Homo sapiens ] |
Official Symbol | C7orf61 |
Synonyms | C7ORF61; chromosome 7 open reading frame 61; uncharacterized protein C7orf61; IMAGE:4839025; |
Gene ID | 402573 |
mRNA Refseq | NM_001004323 |
Protein Refseq | NP_001004323 |
MIM | 619782 |
UniProt ID | Q8IZ16 |
◆ Recombinant Proteins | ||
C7orf61-0153H | Recombinant Human C7orf61 Protein, GST-Tagged | +Inquiry |
C7orf61-2632HF | Recombinant Full Length Human C7orf61 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C7orf61-7958HCL | Recombinant Human C7orf61 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C7orf61 Products
Required fields are marked with *
My Review for All C7orf61 Products
Required fields are marked with *
0
Inquiry Basket