Recombinant Full Length Human C7orf49 Protein, GST-tagged

• Cat.No.: C7orf49-2627HF
• Product Overview: Human C7orf49 full-length ORF (AAH00168.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 129 amino acids
• Description: C7orf49 (Chromosome 7 Open Reading Frame 49) is a Protein Coding gene.
• Molecular Mass: 40.59 kDa
• AA Sequence: MKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C7orf49 chromosome 7 open reading frame 49 [ Homo sapiens ]
• Official Symbol: C7orf49
• Synonyms: C7ORF49; chromosome 7 open reading frame 49; modulator of retrovirus infection homolog; FLJ22450; FLJ27285; MGC5242; modulator of retrovirus infection; MRI
• Gene ID: 78996
• mRNA Refseq: NM_001243749
• Protein Refseq: NP_001230678
• MIM: 616980
• UniProt ID: Q9BWK5