Recombinant Full Length Human C7orf33 Protein, GST-tagged

• Cat.No.: C7orf33-2622HF
• Product Overview: Human C7orf33 full-length ORF (NP_660347.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C7orf33 (Chromosome 7 Open Reading Frame 33) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.9 kDa
• Protein length: 177 amino acids
• AA Sequence: MQVEVQSLSLEECPWRLPGPQCECEALLPSGARRRIDLRLSGRAVAVWVHVRGGPGQFNLSYATGRHKKPNPHQNMNRGMEFIAPVSAPTKSGAPWHFLSQGPTDAQRAVRIRPGTRMGLSSDPVVGTLSSSYLDLLTLSYKPGRTVTSSYLNVRGHEVRKLQNSVEATRISRTDSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C7orf33 chromosome 7 open reading frame 33 [ Homo sapiens (human) ]
• Official Symbol: C7orf33
• Synonyms: C7orf33; chromosome 7 open reading frame 33; uncharacterized protein C7orf33; Chromosome 7 Open Reading Frame 33
• Gene ID: 202865
• mRNA Refseq: NM_145304
• Protein Refseq: NP_660347
• UniProt ID: Q8WU49