Recombinant Full Length Human C5orf51 Protein, GST-tagged

• Cat.No.: C5orf51-2677HF
• Product Overview: Human C5orf51 full-length ORF (NP_787117.3, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C5orf51 (Chromosome 5 Open Reading Frame 51) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 60 kDa
• Protein length: 294 amino acids
• AA Sequence: MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLYMYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C5orf51 chromosome 5 open reading frame 51 [ Homo sapiens ]
• Official Symbol: C5orf51
• Synonyms: C5ORF51; chromosome 5 open reading frame 51; UPF0600 protein C5orf51; LOC285636
• Gene ID: 285636
• mRNA Refseq: NM_175921
• Protein Refseq: NP_787117
• UniProt ID: A6NDU8