Recombinant Full Length Human C5orf51 Protein, GST-tagged
Cat.No. : | C5orf51-2677HF |
Product Overview : | Human C5orf51 full-length ORF (NP_787117.3, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | C5orf51 (Chromosome 5 Open Reading Frame 51) is a Protein Coding gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 60 kDa |
Protein length : | 294 amino acids |
AA Sequence : | MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLYMYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C5orf51 chromosome 5 open reading frame 51 [ Homo sapiens ] |
Official Symbol | C5orf51 |
Synonyms | C5ORF51; chromosome 5 open reading frame 51; UPF0600 protein C5orf51; LOC285636; |
Gene ID | 285636 |
mRNA Refseq | NM_175921 |
Protein Refseq | NP_787117 |
UniProt ID | A6NDU8 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All C5orf51 Products
Required fields are marked with *
My Review for All C5orf51 Products
Required fields are marked with *
0
Inquiry Basket