Recombinant Full Length Human C5orf46 Protein, GST-tagged

Cat.No. : C5orf46-2676HF
Product Overview : Human C5orf46 full-length ORF (AAH21680.1, 1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 72 amino acids
Description : C5orf46 (Chromosome 5 Open Reading Frame 46) is a Protein Coding gene.
Molecular Mass : 34.32 kDa
AA Sequence : MAVLVLRLTVVLGLLVLFLTCYADDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENAVEFILRSMSRST
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C5orf46 chromosome 5 open reading frame 46 [ Homo sapiens (human) ]
Official Symbol C5orf46
Synonyms C5orf46; chromosome 5 open reading frame 46; uncharacterized protein C5orf46; CTC-327F10.5; skin and saliva secreted protein 1;
Gene ID 389336
mRNA Refseq NM_206966
Protein Refseq NP_996849
UniProt ID Q6UWT4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C5orf46 Products

Required fields are marked with *

My Review for All C5orf46 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon