Recombinant Full Length Human C4orf45 Protein, GST-tagged
Cat.No. : | C4orf45-2650HF |
Product Overview : | Human C4orf45 full-length ORF (BAB71665.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 188 amino acids |
Description : | C4orf45 (Chromosome 4 Open Reading Frame 45) is a Protein Coding gene. |
Molecular Mass : | 48.3 kDa |
AA Sequence : | MASVSYQKPTSTTVGKQMIFTGPDYIKDYLPKIHQHTSYVGEQHLALEKTGDLRYLWRPASNRSLPAKYKHKYVGEIGWRIPQYNFINKSRLESGFHIKYEELSQASLDSITHRYQNPWQPKPHVLDMQGEQSRASFAWHMSAFEDTDQRNSKWAILVRQCKSSLPRASKPPKLPKLPKRKRKGNINL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C4orf45 chromosome 4 open reading frame 45 [ Homo sapiens ] |
Official Symbol | C4orf45 |
Synonyms | C4ORF45; chromosome 4 open reading frame 45; uncharacterized protein C4orf45; FLJ25371; |
Gene ID | 152940 |
mRNA Refseq | NM_152543 |
Protein Refseq | NP_689756 |
UniProt ID | Q96LM5 |
◆ Recombinant Proteins | ||
C4orf45-2650HF | Recombinant Full Length Human C4orf45 Protein, GST-tagged | +Inquiry |
C4orf45-0073H | Recombinant Human C4orf45 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C4orf45 Products
Required fields are marked with *
My Review for All C4orf45 Products
Required fields are marked with *
0
Inquiry Basket