Recombinant Full Length Human C4orf45 Protein, GST-tagged

Cat.No. : C4orf45-2650HF
Product Overview : Human C4orf45 full-length ORF (BAB71665.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 188 amino acids
Description : C4orf45 (Chromosome 4 Open Reading Frame 45) is a Protein Coding gene.
Molecular Mass : 48.3 kDa
AA Sequence : MASVSYQKPTSTTVGKQMIFTGPDYIKDYLPKIHQHTSYVGEQHLALEKTGDLRYLWRPASNRSLPAKYKHKYVGEIGWRIPQYNFINKSRLESGFHIKYEELSQASLDSITHRYQNPWQPKPHVLDMQGEQSRASFAWHMSAFEDTDQRNSKWAILVRQCKSSLPRASKPPKLPKLPKRKRKGNINL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C4orf45 chromosome 4 open reading frame 45 [ Homo sapiens ]
Official Symbol C4orf45
Synonyms C4ORF45; chromosome 4 open reading frame 45; uncharacterized protein C4orf45; FLJ25371;
Gene ID 152940
mRNA Refseq NM_152543
Protein Refseq NP_689756
UniProt ID Q96LM5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C4orf45 Products

Required fields are marked with *

My Review for All C4orf45 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon