Recombinant Full Length Human C3orf35 Protein

• Cat.No.: C3orf35-2592HF
• Product Overview: Human C3orf35 full-length ORF (ADR83466.1) recombinant protein without tag.

Specification

• Description: C3orf35 (Chromosome 3 Open Reading Frame 35) is a Protein Coding gene. Diseases associated with C3orf35 include Muir-Torre Syndrome.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 13.1 kDa
• Protein length: 170 amino acids
• AA Sequence: MKTMATRKRCKLSRTGPEFENVIKRLLCARTFHTRIGGDLTHGIINRGRRANAEQMGLQGSAQHFNIFPLDLWTQGDCMLVSLAKNKVNVFGAIINMAASVSGVIGGLKFSRTYYVKGI
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: C3orf35 chromosome 3 open reading frame 35 [ Homo sapiens (human) ]
• Official Symbol: C3orf35
• Synonyms: C3orf35; chromosome 3 open reading frame 35; APRG1; AP20 region protein 1; AP20 region protein1; APRG1 tumor suppressor candidate; Chromosome 3 Open Reading Frame 35; APRG1 Tumor Suppressor Candidate; APRG1; AP20 Region Protein 1; AP20 Region Protein1; AP20 Region Protein
• Gene ID: 339883
• mRNA Refseq: NM_001302831
• Protein Refseq: NP_001289760
• MIM: 611429
• UniProt ID: Q8IVJ8