Recombinant Full Length Human C3orf22 Protein, GST-tagged

• Cat.No.: C3orf22-2612HF
• Product Overview: Human C3orf22 full-length ORF (NP_689746.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C3orf22 (Chromosome 3 Open Reading Frame 22) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42.1 kDa
• Protein length: 141 amino acids
• AA Sequence: MDSSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFTSPSGSCPAPLPAPSPPPLCNLWELKLLSRRFPRQLAFLLSTRHTEAACPQTSKAAGLSRGLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C3orf22 chromosome 3 open reading frame 22 [ Homo sapiens (human) ]
• Official Symbol: C3orf22
• Synonyms: C3orf22; chromosome 3 open reading frame 22; uncharacterized protein C3orf22
• Gene ID: 152065
• mRNA Refseq: NM_152533
• Protein Refseq: NP_689746
• UniProt ID: Q8N5N4