Recombinant Full Length Human C1QTNF6 Protein, C-Flag-tagged
Cat.No. : | C1QTNF6-692HFL |
Product Overview : | Recombinant Full Length Human C1QTNF6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable identical protein binding activity. Predicted to be located in extracellular space. Predicted to be integral component of membrane. Predicted to be part of protein-containing complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 30.7 kDa |
AA Sequence : | MQWLRVRESPGEATGHRVTMVTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAH VSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQ KRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIM HNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | C1QTNF6 C1q and TNF related 6 [ Homo sapiens (human) ] |
Official Symbol | C1QTNF6 |
Synonyms | CTFP6; CTRP6; ZACRP6 |
Gene ID | 114904 |
mRNA Refseq | NM_031910.4 |
Protein Refseq | NP_114116.3 |
MIM | 614910 |
UniProt ID | Q9BXI9 |
◆ Recombinant Proteins | ||
C1qtnf6-2323M | Recombinant Mouse C1qtnf6 protein, His-tagged | +Inquiry |
C1qtnf6-2322M | Recombinant Mouse C1qtnf6 protein, His-sumostar-tagged | +Inquiry |
C1QTNF6-469H | Recombinant Human C1QTNF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
C1qtnf6-646M | Recombinant Mouse C1qtnf6 protein, His-SUMO-tagged | +Inquiry |
C1QTNF6-692HFL | Recombinant Full Length Human C1QTNF6 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF6-8135HCL | Recombinant Human C1QTNF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1QTNF6 Products
Required fields are marked with *
My Review for All C1QTNF6 Products
Required fields are marked with *
0
Inquiry Basket