Recombinant Full Length Human C1QTNF6 Protein, C-Flag-tagged

• Cat.No.: C1QTNF6-692HFL
• Product Overview: Recombinant Full Length Human C1QTNF6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Predicted to enable identical protein binding activity. Predicted to be located in extracellular space. Predicted to be integral component of membrane. Predicted to be part of protein-containing complex.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 30.7 kDa
• AA Sequence: MQWLRVRESPGEATGHRVTMVTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAH VSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQ KRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIM HNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Secreted Protein, Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: C1QTNF6 C1q and TNF related 6 [ Homo sapiens (human) ]
• Official Symbol: C1QTNF6
• Synonyms: CTFP6; CTRP6; ZACRP6
• Gene ID: 114904
• mRNA Refseq: NM_031910.4
• Protein Refseq: NP_114116.3
• MIM: 614910
• UniProt ID: Q9BXI9