Recombinant Full Length Human C19orf73 Protein, GST-tagged

• Cat.No.: C19orf73-4839HF
• Product Overview: Human FLJ10490 full-length ORF (BAA91643.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 129 amino acids
• Description: C19orf73 (Chromosome 19 Open Reading Frame 73) is a Protein Coding gene.
• Molecular Mass: 40.1 kDa
• AA Sequence: MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQTVVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVGGVVLSSAPALRPRLGPCLRPPPSD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C19orf73 chromosome 19 open reading frame 73 [ Homo sapiens (human) ]
• Official Symbol: C19orf73
• Synonyms: C19orf73; chromosome 19 open reading frame 73; putative uncharacterized protein C19orf73
• Gene ID: 55150
• mRNA Refseq: NM_018111
• Protein Refseq: NP_060581
• UniProt ID: Q9NVV2