Recombinant Full Length Human C12orf76 Protein, GST-tagged

• Cat.No.: C12orf76-4907HF
• Product Overview: Human FLJ40142 full-length ORF (BAC05063.1, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C12orf76 (Chromosome 12 Open Reading Frame 76) is a Protein Coding gene. GO annotations related to this gene include ion channel activity and purinergic nucleotide receptor activity.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 41.25 kDa
• Protein length: 135 amino acids
• AA Sequence: MFQNLQGTFEKEIGKIIPFTIAFKRAEAVEPDGCVQSWRCCLPCDLGQASRFIHTTVCSAIRWRSCKGERNFAERHILPAELEEQSNHAGMGPILPAMPSVDGNHFQHPAGDCHPYGILCLQAHSASVTARQVLQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C12orf76 chromosome 12 open reading frame 76 [ Homo sapiens (human) ]
• Official Symbol: C12orf76
• Synonyms: C12orf76; chromosome 12 open reading frame 76; uncharacterized protein C12orf76
• Gene ID: 400073
• mRNA Refseq: NM_207435
• Protein Refseq: NP_997318
• UniProt ID: Q8N812