Recombinant Full Length Human C11orf65 Protein, GST-tagged

• Cat.No.: C11orf65-1845HF
• Product Overview: Human C11orf65 full-length ORF ( AAH59411.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 313 amino acids
• Description: Predicted to be involved in negative regulation of mitochondrial fission and negative regulation of protein targeting to mitochondrion. Predicted to be located in cytosol and mitochondrial outer membrane.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 63 kDa
• AA Sequence: MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQIVKYINPKEAELLDAAAGIHVRFRLGGVKFPPDIYYKIFTHRPIEDLCANSPRNYAKLPAKHTSHNKNDHLQEEDHSGWYHRIENNGWRPVSDTFWLSTDGMVVEDKKESEFHFSKLKRRQDLEKKRKLRKIELMRQMYYSGSLEAKSTHHETLGLIHTATKGLIRAFEDGGIDSVMEWEVDEVLNWTNTLNLDEYIASWKEIATSNSSANFKGFRFNQAQKNIYNYGGDISKMQMGIPDDTYYENVYQEPNVTRLTPDSTYGL
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C11orf65 chromosome 11 open reading frame 65 [ Homo sapiens ]
• Official Symbol: C11orf65
• Synonyms: C11ORF65; chromosome 11 open reading frame 65; uncharacterized protein C11orf65; MGC33948
• Gene ID: 160140
• mRNA Refseq: NM_152587
• Protein Refseq: NP_689800
• UniProt ID: Q8NCR3