Recombinant Full Length Human C11orf1 Protein, GST-tagged
| Cat.No. : | C11orf1-1794HF |
| Product Overview : | Human C11orf1 full-length ORF ( NP_073598.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Located in nucleoplasm. |
| Source : | In Vitro Cell Free System |
| Species : | Human |
| Tag : | GST |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 44.2 kDa |
| Protein length : | 150 amino acids |
| AA Sequence : | MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTNENTYSNRTLMGNWNQERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEKSTYMNSYSKP |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C11orf1 chromosome 11 open reading frame 1 [ Homo sapiens ] |
| Official Symbol | C11orf1 |
| Synonyms | Chromosome 11 Open Reading Frame 1; UPF0686 Protein C11orf1; FLJ23499 |
| Gene ID | 64776 |
| mRNA Refseq | NM_022761.2 |
| Protein Refseq | NP_073598.1 |
| UniProt ID | Q9H5F2 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C11orf1 Products
Required fields are marked with *
My Review for All C11orf1 Products
Required fields are marked with *
0
Inquiry Basket
