Recombinant Full Length Human C10orf55 Protein, GST-tagged
Cat.No. : | C10orf55-1728HF |
Product Overview : | Human C10orf55 full-length ORF (BAC03908.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 127 amino acids |
Description : | Enables identical protein binding activity. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 40.37 kDa |
AA Sequence : | MELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPIPKPTLPSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESGPAVDGIRRTPAP |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C10orf55 chromosome 10 open reading frame 55 [ Homo sapiens ] |
Official Symbol | C10orf55 |
Synonyms | bA417O11.3 |
Gene ID | 414236 |
mRNA Refseq | NM_001001791.2 |
Protein Refseq | NP_001001791.2 |
UniProt ID | Q5SWW7 |
◆ Recombinant Proteins | ||
C10orf55-436H | Recombinant Human C10orf55 Protein, GST-tagged | +Inquiry |
C10orf55-2809H | Recombinant Human C10orf55 protein, His-tagged | +Inquiry |
C10orf55-1728HF | Recombinant Full Length Human C10orf55 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf55-8364HCL | Recombinant Human C10orf55 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C10orf55 Products
Required fields are marked with *
My Review for All C10orf55 Products
Required fields are marked with *
0
Inquiry Basket