Recombinant Full Length Human C10orf55 Protein, GST-tagged

Cat.No. : C10orf55-1728HF
Product Overview : Human C10orf55 full-length ORF (BAC03908.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 127 amino acids
Description : Enables identical protein binding activity.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 40.37 kDa
AA Sequence : MELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPIPKPTLPSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESGPAVDGIRRTPAP
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C10orf55 chromosome 10 open reading frame 55 [ Homo sapiens ]
Official Symbol C10orf55
Synonyms bA417O11.3
Gene ID 414236
mRNA Refseq NM_001001791.2
Protein Refseq NP_001001791.2
UniProt ID Q5SWW7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C10orf55 Products

Required fields are marked with *

My Review for All C10orf55 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon