Recombinant Full Length Human BZW1 Protein, GST-tagged

• Cat.No.: BZW1-1698HF
• Product Overview: Human BZW1 full-length ORF ( NP_055485.2, 1 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 353 amino acids
• Description: Enables RNA binding activity and cadherin binding activity. Located in cytoplasm.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 66.9 kDa
• AA Sequence: MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEEMKKNNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BZW1 basic leucine zipper and W2 domains 1 [ Homo sapiens ]
• Official Symbol: BZW1
• Synonyms: BZW1; basic leucine zipper and W2 domains 1; basic leucine zipper and W2 domain-containing protein 1; BZAP45; KIAA0005; basic leucine-zipper protein BZAP45; putative protein product of Nbla10236; Nbla10236
• Gene ID: 9689
• mRNA Refseq: NM_001207067
• Protein Refseq: NP_001193996
• MIM: 619252
• UniProt ID: Q7L1Q6