Recombinant Full Length Human BTK Protein, C-Flag-tagged
Cat.No. : | BTK-985HFL |
Product Overview : | Recombinant Full Length Human BTK Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 76.1 kDa |
AA Sequence : | MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPE KNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQ KYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAP VSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYE WYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKH LFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMR HRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFP VRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIM YSCWHEKADERPTFKILLSNILDVMDEESTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Primary immunodeficiency |
Full Length : | Full L. |
Gene Name | BTK Bruton tyrosine kinase [ Homo sapiens (human) ] |
Official Symbol | BTK |
Synonyms | AT; ATK; BPK; XLA; IMD1; AGMX1; IGHD3; PSCTK1 |
Gene ID | 695 |
mRNA Refseq | NM_000061.3 |
Protein Refseq | NP_000052.1 |
MIM | 300300 |
UniProt ID | Q06187 |
◆ Recombinant Proteins | ||
BTK-255H | Recombinant Human BTK, His-tagged, Active | +Inquiry |
BTK-398H | Active Recombinant Human BTK protein, His-tagged | +Inquiry |
BTK-398HF | Recombinant Human BTK Protein, His-tagged, FITC conjugated | +Inquiry |
BTK-7095HF | Active Recombinant Full Length Human BTK Protein, DDK-tagged, Biotinylated | +Inquiry |
Btk-1967R | Recombinant Rat Btk protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTK-001HCL | Recombinant Human BTK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTK Products
Required fields are marked with *
My Review for All BTK Products
Required fields are marked with *
0
Inquiry Basket