Recombinant Full Length Human BRWD1 Protein, GST-tagged

• Cat.No.: BRWD1-3823HF
• Product Overview: Human BRWD1 full-length ORF ( NP_001007247.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 120 amino acids
• Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats, and the function of this protein is not known. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates 3 transcript variants diverging at the 3 ends.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 40 kDa
• AA Sequence: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BRWD1 bromodomain and WD repeat domain containing 1 [ Homo sapiens ]
• Official Symbol: BRWD1
• Synonyms: BRWD1; bromodomain and WD repeat domain containing 1; C21orf107, chromosome 21 open reading frame 107 , WD repeat domain 9 , WDR9; bromodomain and WD repeat-containing protein 1; FLJ11315; N143; transcriptional unit N143; WD repeat protein WDR9-form2; WD repeat-containing protein 9; WDR9; C21orf107; FLJ43918
• Gene ID: 54014
• mRNA Refseq: NM_001007246
• Protein Refseq: NP_001007247
• MIM: 617824
• UniProt ID: Q9NSI6