Recombinant Full Length Human BRCA1 Protein, GST-tagged
Cat.No. : | BRCA1-3782HF |
Product Overview : | Human BRCA1 full-length ORF ( NP_009237.1, 1 a.a. - 59 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 59 amino acids |
Description : | This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 33.1 kDa |
AA Sequence : | MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKVLLCCPSWSTVVRS |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BRCA1 breast cancer 1, early onset [ Homo sapiens ] |
Official Symbol | BRCA1 |
Synonyms | BRCA1; breast cancer 1, early onset; breast cancer type 1 susceptibility protein; BRCA1/BRCA2 containing complex; subunit 1; BRCC1; PPP1R53; protein phosphatase 1; regulatory subunit 53; RNF53; RING finger protein 53; BRCA1/BRCA2-containing complex, subunit 1; protein phosphatase 1, regulatory subunit 53; breast and ovarian cancer susceptibility protein 1; breast and ovarian cancer sususceptibility protein 1; IRIS; PSCP; BRCAI; PNCA4; BROVCA1; |
Gene ID | 672 |
mRNA Refseq | NM_007294 |
Protein Refseq | NP_009225 |
MIM | 113705 |
UniProt ID | P38398 |
◆ Recombinant Proteins | ||
BRCA1-5256H | Recombinant Human BRCA1 protein, His-tagged | +Inquiry |
BRCA1-668R | Recombinant Rat BRCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BRCA1-390R | Recombinant Rhesus Macaque BRCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BRCA1-5743C | Recombinant Chicken BRCA1 | +Inquiry |
BRCA1-1010R | Recombinant Rat BRCA1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BRCA1 Products
Required fields are marked with *
My Review for All BRCA1 Products
Required fields are marked with *
0
Inquiry Basket