Recombinant Full Length Human BPY2C Protein, GST-tagged

Description :	This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. The encoded protein interacts with ubiquitin protein ligase E3A and may be involved in male germ cell development and male infertility. Three nearly identical copies of this gene exist on chromosome Y; two copies are part of a palindromic region. This record represents the more telomeric copy within the palindrome.
Source :	In Vitro Cell Free System
Species :	Human
Tag :	GST
Form :	50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	38.06 kDa
Protein length :	106 amino acids
AA Sequence :	MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	BPY2C basic charge, Y-linked, 2C [ Homo sapiens ]
Official Symbol	BPY2C
Synonyms	BPY2C; basic charge, Y-linked, 2C; testis-specific basic protein Y 2; VCY2C; basic charge, Y-linked 2; variable charge, Y-linked, 2; variably charged protein Y 2; basic protein on Y chromosome 2; testis-specific basic protein on Y, 2; BPY2; VCY2;
Gene ID	442868
mRNA Refseq	NM_001002761
Protein Refseq	NP_001002761
UniProt ID	O14599