Recombinant Full Length Human BPIFB2 Protein, GST-tagged

• Cat.No.: BPIFB2-3771HF
• Product Overview: Human BPIL1 full-length ORF ( NP_079503.1, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the lipid transfer/lipopolysaccharide binding protein (LT/LBP) gene family. It is highly expressed in hypertrophic tonsils. This gene and three other members of the LT/LBP gene family form a cluster on the long arm of chromosome 20.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 75.6 kDa
• Protein length: 458 amino acids
• AA Sequence: MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDVVVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNALLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BPIFB2 BPI fold containing family B, member 2 [ Homo sapiens ]
• Official Symbol: BPIFB2
• Synonyms: BPIFB2; BPI fold containing family B, member 2; bactericidal/permeability increasing protein like 1 , BPIL1, C20orf184; BPI fold-containing family B member 2; dJ726C3.2; LPLUNC2; BPI-like 1; bactericidal/permeability-increasing protein-like 1; long palate, lung and nasal epithelium carcinoma-associated protein 2; RYSR; BPIL1; C20orf184
• Gene ID: 80341
• mRNA Refseq: NM_025227
• Protein Refseq: NP_079503
• MIM: 614108
• UniProt ID: Q8N4F0