Recombinant Full Length Human BPIFB2 Protein, GST-tagged

Cat.No. : BPIFB2-3771HF
Product Overview : Human BPIL1 full-length ORF ( NP_079503.1, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 458 amino acids
Description : This gene encodes a member of the lipid transfer/lipopolysaccharide binding protein (LT/LBP) gene family. It is highly expressed in hypertrophic tonsils. This gene and three other members of the LT/LBP gene family form a cluster on the long arm of chromosome 20.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 75.6 kDa
AA Sequence : MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDVVVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNALLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BPIFB2 BPI fold containing family B, member 2 [ Homo sapiens ]
Official Symbol BPIFB2
Synonyms BPIFB2; BPI fold containing family B, member 2; bactericidal/permeability increasing protein like 1 , BPIL1, C20orf184; BPI fold-containing family B member 2; dJ726C3.2; LPLUNC2; BPI-like 1; bactericidal/permeability-increasing protein-like 1; long palate, lung and nasal epithelium carcinoma-associated protein 2; RYSR; BPIL1; C20orf184;
Gene ID 80341
mRNA Refseq NM_025227
Protein Refseq NP_079503
MIM 614108
UniProt ID Q8N4F0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BPIFB2 Products

Required fields are marked with *

My Review for All BPIFB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon