Recombinant Full Length Human BOLA2 Protein, GST-tagged

• Cat.No.: BOLA2-3764HF
• Product Overview: Human BOLA2 full-length ORF ( ADR83317.1, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is located within a region of a segmental duplication on chromosome 16p. The product of this gene belongs to the eukaryotic subfamily of the BolA-like proteins. This gene encodes the BolA-like protein 2. The BolA-like proteins are widely conserved from prokaryotes to eukaryotes, and these proteins seem to be involved in cell proliferation or cell-cycle regulation.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 13.7 kDa
• Protein length: 124 amino acids
• AA Sequence: MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKFEGKPLLQRHRFCTE
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BOLA2 bolA family member 2 [ Homo sapiens (human) ]
• Official Symbol: BOLA2
• Synonyms: My016; BOLA2A; BOLA2B
• Gene ID: 552900
• mRNA Refseq: NM_001031827.1
• Protein Refseq: NP_001026997.1
• MIM: 613182
• UniProt ID: Q9H3K6.1