Recombinant Full Length Human BOLA2 Protein, GST-tagged
Cat.No. : | BOLA2-3764HF |
Product Overview : | Human BOLA2 full-length ORF ( ADR83317.1, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 124 amino acids |
Description : | This gene is located within a region of a segmental duplication on chromosome 16p. The product of this gene belongs to the eukaryotic subfamily of the BolA-like proteins. This gene encodes the BolA-like protein 2. The BolA-like proteins are widely conserved from prokaryotes to eukaryotes, and these proteins seem to be involved in cell proliferation or cell-cycle regulation. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 13.7 kDa |
AA Sequence : | MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKFEGKPLLQRHRFCTE |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BOLA2 bolA family member 2 [ Homo sapiens (human) ] |
Official Symbol | BOLA2 |
Synonyms | My016; BOLA2A; BOLA2B |
Gene ID | 552900 |
mRNA Refseq | NM_001031827.1 |
Protein Refseq | NP_001026997.1 |
MIM | 613182 |
UniProt ID | Q9H3K6.1 |
◆ Recombinant Proteins | ||
BOLA2-1067M | Recombinant Mouse BOLA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BOLA2-381R | Recombinant Rhesus Macaque BOLA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BOLA2-2454M | Recombinant Mouse BOLA2 Protein | +Inquiry |
BOLA2-3764HF | Recombinant Full Length Human BOLA2 Protein, GST-tagged | +Inquiry |
BOLA2-302H | Recombinant Human BOLA2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BOLA2 Products
Required fields are marked with *
My Review for All BOLA2 Products
Required fields are marked with *
0
Inquiry Basket