Recombinant Full Length Human BOD1L2 Protein, GST-tagged

• Cat.No.: BOD1L2-4685HF
• Product Overview: Human FAM44C full-length ORF ( AAH21740.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 172 amino acids
• Description: BOD1L2 (Biorientation Of Chromosomes In Cell Division 1 Like 2) is a Protein Coding gene. An important paralog of this gene is BOD1.
• Molecular Mass: 44.5 kDa
• AA Sequence: MADGGGGGSGGAGPASTRASGGGGPINPASLPPGDPQLIAIIVGQLKSRGLFDSFRRDCKADVDTKPAYQNLSQKADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQIIHEFLVAQKEAAVPALPPEPEGQDPPAPSQDTS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BOD1L2 biorientation of chromosomes in cell division 1 like 2 [ Homo sapiens (human) ]
• Official Symbol: BOD1L2
• Synonyms: BOD1L2; biorientation of chromosomes in cell division 1 like 2; Biorientation Of Chromosomes In Cell Division 1 Like 2; Biorientation Of Chromosomes In Cell Division Protein 1 Pseudogene; Biorientation Of Chromosomes In Cell Division 1 Pseudogene; Family With Sequence Similarity 44, Member C; FAM44C; BOD1P; Putative Biorientation Of Chromosomes In Cell Division Protein 1 Pseudogene; Putative Biorientation Of Chromosomes In Cell Division Protein 1-Like 2; Biorientation Of Chromosomes In Cell Division Protein 1-Like 2; Putative Protein FAM44C; Protein FAM44C; biorientation of chromosomes in cell division protein 1-like 2; biorientation of chromosomes in cell division 1 pseudogene; biorientation of chromosomes in cell division protein 1 pseudogene; family with sequence similarity 44, member C; putative biorientation of chromosomes in cell division protein 1 pseudogene; putative biorientation of chromosomes in cell division protein 1-like 2; putative protein FAM44C
• Gene ID: 284257
• mRNA Refseq: NM_001257964
• Protein Refseq: NP_001244893
• UniProt ID: Q8IYS8